PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019529m
Common NameCICLE_v10019529mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 562aa    MW: 61049.6 Da    PI: 6.1931
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019529mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.23.4e-24212254244
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       epgrCrRtDGKkWRCsr+v +++k+CErHlhrgr rsrk++e
  Ciclev10019529m 212 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHLHRGRPRSRKPVE 254
                      69**************************************987 PP

2QLQ53.76.1e-19152185235
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                      +FT+aQ+ +L++Q+l+yK+++a++PvP++Ll++ 
  Ciclev10019529m 152 PFTNAQWTELERQALIYKCMVASVPVPSDLLFPF 185
                      8******************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.4E-11151187IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-12152184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.368152187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65211255IPR014977WRC domain
PfamPF088791.4E-20213254IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MMSGRIMDAC DFSFINEAAA EEGKVKEAGS NRHRPSPSDE FGWGDAVAGG PTCNNNINNS  60
SSSNHIYKTI GYVSSDSSGS STSMKTLQPF QFDIAAATVN ESPGLYVYFI FQDRAESCNL  120
LLYCDNEQSL FYFYLFLFFI FGVGMAARMG FPFTNAQWTE LERQALIYKC MVASVPVPSD  180
LLFPFTRNRN SAAAAAAPVG LDLIRLSKGG DLEPGRCRRT DGKKWRCSRD VAPDQKYCER  240
HLHRGRPRSR KPVELQPPPN SKKKTRLQSH PLNTTNTVNN SNNNNLDFSA SQFVRNFTQY  300
PHPHVREQRC LDKDWMMRGE AVHLPSNAAG TEWNHLINNP ASPVNINQHY HLEEPLNLNS  360
FASFSAGEAQ QSNDCPFYTD PDLVPRVFID AWSNANGVSN GDDQIHNTNS GTKSSVSSSG  420
NLSLSPLSLS MGGNSTIDEE MGQLQMGLGL VESSQDHKCD TNPQLSSWLN PDSWAPGGPL  480
AEVLRPSTVP ASASGPPSPA AGNGDSDSPP ATTVSSPSGV LQKALVSWSD SSGNSSPTPG  540
SSRTNKSEIA LLWFGQGKLE S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.75310.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441218.10.0hypothetical protein CICLE_v10019529mg
TrEMBLV4T2N10.0V4T2N1_9R
STRINGPOPTR_0012s02950.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121062731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-34growth-regulating factor 7